SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012515 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012515
Domain Number 1 Region: 76-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.87e-19
Family Ubiquitin-related 0.00014
Further Details:      
 
Domain Number 2 Region: 4-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000117
Family Ubiquitin-related 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012515   Gene: ENSTTRG00000013195   Transcript: ENSTTRT00000013191
Sequence length 166
Comment pep:novel genescaffold:turTru1:GeneScaffold_3233:12538:13493:1 gene:ENSTTRG00000013195 transcript:ENSTTRT00000013191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRNLKVKMLGGQEILVPLRDSMLSSELKQQITQQIGVPAFQQLLVHQDTRKVLQDGVPL
VCQGLGPDSTVLLMVQSCKDPLSILVRNNKGRSSTYVVQLTQRVAELKLQVCQKEHVQAD
QFWLSFEGKPMEDAHQLGEYGLTTMCTVFMNLRLRGGGAGPGGPRG
Download sequence
Identical sequences ENSTTRP00000012515 ENSTTRP00000012515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]