SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012541 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012541
Domain Number 1 Region: 128-394
Classification Level Classification E-value
Superfamily vWA-like 6.67e-90
Family Trunk domain of Sec23/24 0.000000618
Further Details:      
 
Domain Number 2 Region: 8-66,411-505
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.02e-62
Family beta-sandwich domain of Sec23/24 0.00037
Further Details:      
 
Domain Number 3 Region: 623-763
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.85e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.0000067
Further Details:      
 
Domain Number 4 Region: 555-622
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.32e-29
Family Helical domain of Sec23/24 0.0000789
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 6.93e-22
Family Zn-finger domain of Sec23/24 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012541   Gene: ENSTTRG00000013211   Transcript: ENSTTRT00000013219
Sequence length 767
Comment pep:novel genescaffold:turTru1:GeneScaffold_531:8198:45194:1 gene:ENSTTRG00000013211 transcript:ENSTTRT00000013219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACILTPLKERPDLPPVQYEPVL
CSRPTCKAILNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEVNQPAELMPQFSTVEYV
IQRGAQSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQDMLGLTKPAVPVHPARPAQPQEHPSISSRFLQPIHKIDM
NLTDLLGELQRDPWPVPQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFIGGPPTQGP
GMVVGDELKVPIRSWHDIEKDNARFMKKATKHYEMLANRAAANGHCVDIYACALDQTGLL
EMKCCTNLTGGHMVMGDSFNTSLFKQTFQRIFSKDFNGNFRMAFGATLEVKTSRELKVAG
AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNAPIPQGGRGA
IQFVTHYQHSSTQRRIRVTTIARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXCQKFGQYTKEDPASFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETIAQWQKAGYQDMPEYENFKHLLQAPLDDAQEILHTRFPMPRYINTEHGGSQARFL
LSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC
Download sequence
Identical sequences ENSTTRP00000012541 ENSTTRP00000012541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]