SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012658 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012658
Domain Number 1 Region: 7-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-20
Family Ubiquitin-related 0.00012
Further Details:      
 
Domain Number 2 Region: 547-597
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000705
Family UBA domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012658
Domain Number - Region: 217-266
Classification Level Classification E-value
Superfamily ARM repeat 0.00518
Family Mo25 protein 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012658   Gene: ENSTTRG00000013343   Transcript: ENSTTRT00000013343
Sequence length 601
Comment pep:novel genescaffold:turTru1:GeneScaffold_2208:514320:527801:-1 gene:ENSTTRG00000013343 transcript:ENSTTRT00000013343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPSGAETRPPIRVTVKTPKDKEEIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKI
LKDGDTLNQHGIKDGLTVHLVIKTPQKVQDPATATASSPSTPDPASAPSTTPASPATSAQ
PSTSGSATSDTGSGSRRSSGGGTSPGTGEGPPSATASILSGFGGILGLGSLGLGSANFME
LQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLN
NPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMFSAAREQ
FGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHP
TVSNPFGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFA
AQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQ
TEAPGLVPSLGSFGMSRTPASSTGSNAGSAPEAPTSLPAPPATSSPTGASSAQQQLMQQM
IQLLAGSGNSQVQTPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQL
S
Download sequence
Identical sequences ENSTTRP00000012658 ENSTTRP00000012658 XP_004284630.1.21590 XP_004312558.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]