SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012682 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012682
Domain Number 1 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 233-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 4-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 195-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 456-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000725
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000699
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 8 Region: 528-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000485
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012682
Domain Number - Region: 563-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0656
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012682   Gene: ENSTTRG00000013367   Transcript: ENSTTRT00000013367
Sequence length 603
Comment pep:novel scaffold:turTru1:scaffold_109204:162159:174310:-1 gene:ENSTTRG00000013367 transcript:ENSTTRT00000013367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGTQLTFKDVAIEFSQEEWECLDPAQRALYRDVMLETYRNLVSLDISRIHVIKKLHLKA
NTDREEVFQTIMLRRHERNEIKHFYLKVVQENIYDLESQRRAEVRNYKGMTITHNQNLIG
KRDGHGRSTAGVELIENSLALSFLDDLHIFKSEEKINEFTQADKTISSQGKHFYNESDFM
HPSLLTKYQKAPRERPYKCNLCGKTFFQGSHLSRHQIIHTREKLHKCDICEKVFSLNSNL
IVHQRIHTGEKPYKCNECVKVFSQKSNLVVHERIHTGEKPYKCSCGKVFNQKQILATHQR
IHTGEKPYKCNECGKTFSQGSKLRRHQIIHTAENLHKCHICCKAFSRNSDLAVHQRIHSG
EKLHKCNECGKIFSRKSNLAVHKRIHTGEKPYNCNECSKVFVKKAPAKHQRIHNGGKPFK
NNECKDLTHITFTTHQIINTEGKPYCDIYGKVLIQNHLAYHQISHTGRSKCHKCLIVFSQ
NLYLKVHQKIHTGEKPYKYNECGKSFIVLSLTYQVIHIGEGLSQGFSKCTHLLHWKSHTG
EISGKCIYFDQDFRNKFIHQIIHSGELPHKCNEGKTFTRGLHFINYQIIYTRGHYRCTEY
GKA
Download sequence
Identical sequences ENSTTRP00000012682 ENSTTRP00000012682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]