SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012773 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012773
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-41
Family Voltage-gated potassium channels 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012773   Gene: ENSTTRG00000013460   Transcript: ENSTTRT00000013463
Sequence length 741
Comment pep:novel genescaffold:turTru1:GeneScaffold_2085:1169861:1223381:-1 gene:ENSTTRG00000013460 transcript:ENSTTRT00000013463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLIVLGCLILAVLTTFREYETVSGDWLLLLETFAIFIFGAEFALRIWAAGCCCRYKGWRG
RLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTWKL
LGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEFETYADALWW
GLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQEQHRQKHFE
KRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFXXXXXXXXXXXKLGLLDR
VRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGSNNKERFRTAFRMKAYAFWQSSED
AGTADPIAEDRGYGNDFLIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRPYDVKDVIEQ
YSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKAFTYPSQQSPRNEPYVARPSTS
EAEDQSMMGKFVKVERQVRDMGKKLDFLVDMHMQHMERLQVHVTDFCPTKGTSSPAEAER
REDHREADLKTIMCNDSETGAPGAPYSIHQVPIDRAGPYGVFAHDPVNLSRGAPSSGKVH
ATLSSSATTYAERPTVLPILTLLDSRGSYHSQAELHSPCSDRVSPQQRRSITRDSDTPLS
LMSVNHEELERSPSGFSISQDRDDFVFGPSGGSSWMREKRYLAEGETDTDTDPFTPSGSM
PLSSTGDGISDSIWTPSNKPT
Download sequence
Identical sequences ENSTTRP00000012773 ENSTTRP00000012773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]