SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012794 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000012794
Domain Number - Region: 143-220
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000376
Family Ubiquitin-related 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012794   Gene: ENSTTRG00000013479   Transcript: ENSTTRT00000013484
Sequence length 1337
Comment pep:novel scaffold:turTru1:scaffold_109928:14071:272827:-1 gene:ENSTTRG00000013479 transcript:ENSTTRT00000013484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPHASAAKPPTGRKMKARAPPPPGGPTTPNVHRGQRPSRDASPSPPQNLLSRKETLDG
RVVAMTVVLPSGLEKKSVVNGSHAMMDLLVELCLQNHLNPSNHALEIRSSETQQPLNFKP
NTLVGTLNAHTVFLKEKVPEAKVKAGPAKVPEKTVRLVVNYLRTQKAVVRVSPEVPLQSI
LPVICAKCDVSPEHVVLLRDNVAGEELELSKSLNELGIKELYAWDNKRETFRKSSLGNGE
TDKEKKKILGFFKVNKRSDSKAEQLRQPGADSDEDASKSTLGRGSNGCLTTPNSPSVNPR
STTLGPSLSLGSISGVSVKSDLKKRRAPPPPSLSRAEPPVQDKTSEKVSLGSQMDLQKKK
RRAPAPPALQPPPSSPLVPPRTEGREEDRKGRTGVGRQLPQKPPRGTARGPPQLVLPPPP
PYPPDTDVAEPLGFPGEGAVSEASDLRPTLSLPLGPGGPCAVDGVPPLPSEAEETVSVGS
CFASEDTTEDSGVMSSPSDIVSLDSQLDSTKSKDQWATYQEDCSDQDLAGTPELGSQKSP
SWERSGPGDWHLRSGRVAPASHEDEDLFMTGQFQKTLAELDEELEEIEESYETDSSFLTN
CIHSMSGRCPQGTIIPDGDTEAIPVTFIGEVLDDPVDSVAFTNRNNNAGSFDAGSTASKK
AQLPPCQAEHSQQHGQRRAAGPGSPAPSQDPGREVIAASTSTWKDVTPSKMAPKATSASA
LHTHDLNAKEERKVAGSAHGGRTLATRRVSAQPGKEKEGDDKSDVWTLPPWFRDQHPGGS
YGLKYGLTTYKIVPPKSEMKCYDRGASLSTGAIEIDELGNLVSPHTNAGRTIVPTPPALE
AEAPPIGKVKEFWRSDSIEKHSGRPAEGAKRTSTPTTPTNPQPQESRLRAEPTSPDPKAT
LPRPRSPNPEDGRPLEEGRSWPLPAAACPLKVPAANTAEVPFLKPQRRTSSQYVASAIAK
RIGTPKAHTDVGRKPGNAQKTCEEPDPPGRPPMVKDGTTPSLYPETACVSGDRSAAGAHP
GGQISSPYGKLSTQNGPTGIHRTSHGPLITAAQRGQASVGQSCGLSGKQSPGKHRTSSSS
DPKCQPAGTSPPPARSGGDPTPGSALVNGSRWVSVHKEPLHSPRVSDTSSHAGQEPPEWE
EKPGLSSTDVPEADGTLPASIFGPKKKFRPVVQRPAPKDTSLHSALMEAIHSAGGKDRLR
KTPEPGSEGGLKKPSYTETDSERSALLAAIRGHSGTCSLRKVTSSASEELQSLRDAMLSA
HGAEPPGLEDLGIQSPPALPPPSPPSPPVTQAPTASRTASRSSSGPLSNPVDARQALMDA
IRSGTGAARLRKVPLLV
Download sequence
Identical sequences ENSTTRP00000012794 ENSTTRP00000012794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]