SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012910 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012910
Domain Number 1 Region: 291-396
Classification Level Classification E-value
Superfamily Second domain of FERM 8.77e-36
Family Second domain of FERM 0.000000871
Further Details:      
 
Domain Number 2 Region: 395-490
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-30
Family Third domain of FERM 0.00000428
Further Details:      
 
Domain Number 3 Region: 210-290
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.53e-24
Family First domain of FERM 0.0000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012910   Gene: ENSTTRG00000013605   Transcript: ENSTTRT00000013605
Sequence length 864
Comment pep:novel genescaffold:turTru1:GeneScaffold_2236:258683:371242:1 gene:ENSTTRG00000013605 transcript:ENSTTRT00000013605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVAEAENPQQQQQKEEGEGATNSGQQETQLEEAPQAAAEGDNQCEQKLKTSNGD
TPTHEDLTKNKERTSENRGLSRLFSSFLKRPKSQVSEEEGKEVESAKEKGEGHKEIEFGA
SLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEEHREDPDFQTEEGGGLEDCS
KTEVKEESPESVAERELKASQKSIRRHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVC
EHLNLLEEDYFSLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDI
TRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGADYVSDFKLAPNQT
KELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGL
LVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVC
VEHHTFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXAAIDSADRSPRPTSAPAIAQSQAAEGSVPGAPVKKGVVSKTPKETVQVEVKKEE
VPPEQPEPELTEVWKVEKTHIEVTVPTSNGDQIQKLAEKNEDLIRMRKKKRERLDGENIY
IRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPQPSEWDKRLSTHSPFRTLNIN
GQIPTGEGPPLVKTQTVTISDTANAVKSEIPTKDVPIVHTETKTITYEAAQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKE
AKEQHPDMSVTKVVVHQETEISEE
Download sequence
Identical sequences ENSTTRP00000012910 ENSTTRP00000012910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]