SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012970 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012970
Domain Number 1 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-23
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.2e-23
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 345-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-21
Family KRAB domain (Kruppel-associated box) 0.00044
Further Details:      
 
Domain Number 5 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-19
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 6 Region: 512-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.21e-18
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 7 Region: 428-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-18
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000179
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 9 Region: 390-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000346
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 251-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000236
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 94-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000448
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 474-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000124
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012970   Gene: ENSTTRG00000013672   Transcript: ENSTTRT00000013670
Sequence length 639
Comment pep:novel scaffold:turTru1:scaffold_93530:5534:14887:1 gene:ENSTTRG00000013672 transcript:ENSTTRT00000013670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVAFEDVAVNFTLEEWALLNPSQKKLYRDVMRETFRNLASVGKKWEDHDIEDQYKNQG
RKLRSHVVERLCESKEGSQCAGNFSLIPKLSLKKKTTGVKLHECSACGKVFMHHSSLNRH
INRHSGHKLYEYQKYEEKPYKCKECGKAFSYLQCFEKHERKHSGQENYKCKECGKAFRFR
TSFQTHKRIHTGEKPYECKECGKSFMWLTTFQRHMITHTGEKPYKCKECGKVFTFLSALQ
IHEKTHMGEKPYQCKQCGKAFRYRRTFQTHERTHTGEKPYECKQCGKAFISRVGLQNHER
NHNGKKFYECKRCSKAFSYSSSLRKHERNHTGEKPYECKDCGKGFIFLSSLRAHMISHSG
DGPYKCKECKKAFITPSSFQIHVRTHTGEKPYKCKQCGKTFNWPTSIRRHEKSHSGEKPY
ECRQCGKFSCPRSFQSHERRHSGEKPYECKKCGKAFSCQNSCQKHERSHGGEKPYECKEC
EKAFSSLIKFQRHVMKHTGDGPYKCKEYGKVFDCPNYFQSHERIHSVEKPYECKGCCKTF
STPRSLRRHERTHTGEKPHACKECGKAFSYPSFLQKHERSHTGEKPYQCKQCGKAVSYLS
SLRSHERTHSGEKPYECKECGKAFIFLFSFTHDKHTGVG
Download sequence
Identical sequences ENSTTRP00000012970 ENSTTRP00000012970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]