SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012983 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012983
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-23
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 2 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-23
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 300-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-20
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.68e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012983
Domain Number - Region: 172-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000104
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012983   Gene: ENSTTRG00000013688   Transcript: ENSTTRT00000013685
Sequence length 368
Comment pep:novel scaffold:turTru1:scaffold_110746:26955:33183:1 gene:ENSTTRG00000013688 transcript:ENSTTRT00000013685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRPVSFKDVVVGFTQEEWHRLNPAQRALYRDVMLETYSNLVSVGYEGTKPYVILRLEQEE
APWICEASCSGCHCREIWQGNVQKKRRQDMLLRXXXXXXXXXXXXXXXXXXNKFGKISHL
STDLFPSIQNPNNWDSCGKSVNHNLDLNGFKRNYSKKQDECYGYGKLLQHTKHDRRPNGE
KFWECSHCEKAFSHNPALMYKPAVTNSLVYKRKRVPPTEKPHVCTECGKAFCYKSEFIRH
QRSHTGEKPYGCTDCGKAFSHKSTLIKHQRIHTGIRPFECFFCGKAFTQKSHRREHQRTH
TGERPFVCNECGKSFGEKSYLNVHQKIHTGERPYRCRECGKSFSQKSCLNKHWRTHFVQS
SLRSKPNT
Download sequence
Identical sequences ENSTTRP00000012983 ENSTTRP00000012983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]