SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012993 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012993
Domain Number 1 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 17-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 514-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.63e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 556-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 9 Region: 197-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-18
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012993
Domain Number - Region: 149-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0113
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012993   Gene: ENSTTRG00000013699   Transcript: ENSTTRT00000013695
Sequence length 620
Comment pep:novel scaffold:turTru1:scaffold_110746:79715:110703:1 gene:ENSTTRG00000013699 transcript:ENSTTRT00000013695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WCSPDSALFKEEEDMTSSLGTVTFKDVAVDLTQEEWQQMKPAQRDLYRDVMLENYSNLVT
VGCEVTKPDVIFKLEQEEEPWVIEEEMLGRPCPEVWEDDEQIKEQQETLVRKVTSISKKT
LIKENVIECKKVAKVFPLGSDIVTSRQNFYEYDSFDKGFEHNLDLLSYEKGCIREENYEC
NKYGKPFYHCSSHVVSPFKCNQCGQDFNHKFDLIRHERIHAGEKLYECKECGKAFSRKEN
LITHQKIHTGEKPYKCNECGKAFIQMSNLIRHQRIHTGEKPYACKDCWKAFSQKSNLIEH
ERIHTGEKPYECKECGKAFSQKQNLIEHEKIHTGEKPYACNECGRAFSRMSSVNLHMRSH
TGEKPYKCNKCGKAFSQCSVFIIHMRSHTGEKPYVCSECGKAFSQSSSLTVHMRNHTAEK
PYECNECGKAFSRKENLITHQKIHTGEKPYECNECGKAFIQMSNLIRHQRIHTGEKPYAC
TVCGKAFSQKSNLTEHEKIHTGEKPYHCNQCGKAFSQRQNLLEHEKIHTGEKPFKCNECG
KAFSRISSLTLHVRSHTGEKPYECNKCGKAFSQCSLLIIHMRIHTGEKPFECNECGKAFS
QRASLSIHKRGHTGEKRRVY
Download sequence
Identical sequences ENSTTRP00000012993 ENSTTRP00000012993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]