SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013001 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013001
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 263-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 468-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-16
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013001   Gene: ENSTTRG00000013703   Transcript: ENSTTRT00000013703
Sequence length 528
Comment pep:novel scaffold:turTru1:scaffold_110746:198015:221090:-1 gene:ENSTTRG00000013703 transcript:ENSTTRT00000013703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVHGSVTFRDVAIDFSQEEWEFLDSAQRDLYRDVMWENYSNFISLGPSISKPDVTTLLDE
GKEPWMVVREGTRRHHPDLESRYRTNTLSPEKDIYEIYSFQWEIMERIKSYGLQDSFFRN
DWECKSKIEGQKEPREGYFGQVKIASEKMSTYKRHNLLAEYQRIHNGEKLYECKECRKTF
IRRSTLSQHLRIHTGEKPYKCKECGQAFRQRAHLIRHHKLHTGEKPYECKECGKAFTVLQ
ELTQHQRLHTGEKPYECKECGKAFRVHQQLARHQRIHTGEKPYECKACGKTFQCTHLTRH
QRLHTSEKLYECKECGTAFVCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIHTGEKPYEC
KECGKARLSFLTQHQRIHTGEKPYKCKECKKAFRQHSHTQHQKIHNGI
Download sequence
Identical sequences ENSTTRP00000013001 ENSTTRP00000013001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]