SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013036 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013036
Domain Number 1 Region: 391-507
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.45e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.0016
Further Details:      
 
Domain Number 2 Region: 816-944
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.69e-26
Family BCR-homology GTPase activation domain (BH-domain) 0.00092
Further Details:      
 
Domain Number 3 Region: 148-281
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-25
Family Pleckstrin-homology domain (PH domain) 0.00044
Further Details:      
 
Domain Number 4 Region: 1077-1223
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-17
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 5 Region: 292-399
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000189
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 6 Region: 506-686
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000953
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 7 Region: 1034-1097
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000248
Family Ubiquitin-related 0.059
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013036
Domain Number - Region: 761-809
Classification Level Classification E-value
Superfamily PH domain-like 0.00186
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013036   Gene: ENSTTRG00000013743   Transcript: ENSTTRT00000013745
Sequence length 1447
Comment pep:novel genescaffold:turTru1:GeneScaffold_1044:344414:367860:-1 gene:ENSTTRG00000013743 transcript:ENSTTRT00000013745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPRTVFGVLSGYNIIQRLLSPALWRPEASKSPEPSPRSHPVLRSSSEQSALNTVEMMPNA
IYFGLDLRCGAQTAQDAAPDSSQTTAPTPALRPTTGTVHIMDPGCLYYGVQPVGVPGVPD
RREGRVICQERAEHRLSRQDLEAREDAGYASLELPGDSTLSLPALDTETNDDLISPYASF
SSTADRPTPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEM
TRSSKDNKFQVVTGQRVFVFRTESEAQRDTWCSTMQSCLKEQRLLGHPRPPQPPRPLRTG
MLELRGHKAKVFAALSPGELALYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHR
CFSFTAESGGARQSWAAALQEAVTETLSDYEVAEKIWSNRANRHCADCEASRPDWAAVNL
GVVICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGALPPGE
GLHPDSTPGPRGEFISRKYRLGLFRKPHPQYPDHSQLLQALCAAVAGPNLLKNMTQLLCV
EAFEGEEPWSPPALDGSFPGLLPADPCPGVYNEVVVPATYSSFLYCGPVSNKAGPPPPRR
GRDAPLRLWCVLGAALEMFVSESSPEPLNLIQPQDVVCLGVNPPPTDPGDLDRFPFSFEL
VLTGGRIQHFGTDGAESLEAWTSAVGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVSATDTPDKKEHLVLVET
GRTLYLQAEGRLDFSAWNAAIAGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRL
EGVYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLL
PRWREAAELPQKNQRLEKYKEVIGCLPRVNRRTLATLIGHLYRXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQAG
DLIMEVFIEQQLPDNCVTLKVSPTLTAEELTNQVLEIRGTAAGMDLWVTFEIRERGELER
PLHPKERVLEQALQWCQLPEPCSASLLLRKVSLAHAGCLFTGIRRESPRVGLLRCREEPP
RLLGNRFQERFFLLRGRCLLLLKEKKSSKPEREWPLEGAKVYLGIRKKFKPPTPWGFTLI
LEKMHLYLSCTDEDEMWDWATSILKAQHDDQQPVVLRRRSSSDLARQKFGTMPLLPIRGD
DSGATLLSANQTLRRLHNRRTLSMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPEL
TEDTSTSFSITPERTAKPETPLASQRSFDQSPLPKAGPLGWEERPPEPPPGPPSKSSPQS
RGSLEEQLLQELSSLILRKGETTVGLGSPSQPSSPQPPSPNGLPTHTPGFPTQAPCTSSP
SPSQPLT
Download sequence
Identical sequences ENSTTRP00000013036 ENSTTRP00000013036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]