SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013073 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013073
Domain Number 1 Region: 310-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-23
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 2 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 28-86
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 523-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 478-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.63e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 254-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000141
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013073
Domain Number - Region: 109-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0986
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013073   Gene: ENSTTRG00000013782   Transcript: ENSTTRT00000013782
Sequence length 577
Comment pep:novel scaffold:turTru1:scaffold_91463:44660:55001:1 gene:ENSTTRG00000013782 transcript:ENSTTRT00000013782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQLVFTILPTCMGLRQTMNLSRAAGIPAFMAFGDVAVDFTQEEWRLLSPAQRTLHREVML
ETYNHLVSLEIPFCKPKLISQLERGEEPWIEERQRPLSLCPGSKLEIQPCPSCPLAFSSQ
QALSQHVWLSHLPQFFSSLRAGNHLHSGKQYSEDQKQQQEQVFDQTCSSNKAEIQEREED
SKLLFGRVSKSSTSKAFSRTLEEQPVRSKEDNTVVDIVPSPAQRTNLEETDKTLHGLEVS
GFGAIKYGEFGLGFIKESNQLSLQKTHTGETPYMYTEWGESFSSMSVLIKNQRAHSGEKP
FVCRECGRGFTWKSNLVTHQRTHSGEKPYVCKECGRGFTWKSNLFTHQRTHSRVKPYVCK
ECGQSFSLKSNLKTHQRTHSGVKPYVCLECGQCFSLKSNLNKHQRSHTGEKPFVCRECGR
AFTRKSTLITHQRTHSGEKPFVCTECGRGFNDKSTLISHQRTHSGEKPFVCRECGRKFSQ
KPNLFRHKRAHSGSIPFVCRECGQGFCDKLTLITHQRAHSGGKPHVCRECGQGFSRQSHL
IRHQRIHSGEKPYICRKCGQGFSRKSNLIRHQRTHSG
Download sequence
Identical sequences ENSTTRP00000013073 ENSTTRP00000013073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]