SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013074 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013074
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-27
Family KRAB domain (Kruppel-associated box) 0.00079
Further Details:      
 
Domain Number 2 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 547-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 380-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013074
Domain Number - Region: 227-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000223
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 175-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00131
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013074   Gene: ENSTTRG00000013784   Transcript: ENSTTRT00000013783
Sequence length 608
Comment pep:novel scaffold:turTru1:scaffold_91463:90152:101312:1 gene:ENSTTRG00000013784 transcript:ENSTTRT00000013783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGLCKSMSQGLVTFRDVALNFSQEEWEWLDSSQKDLYRDVMLENYRNLVWLGLSVSKP
NMISLLEQGKDPCMVEREMSDGQYAEWDSLYEIKALSPKWYIDEEEISQGMIMERLTSYG
LESSSFREAWKYKGEFEQHQGNQESHFRQVTTLKEISAMKRDNEYNNSEINVLLNSVLLT
QQRVPTVEQVHKFDIYDKMFPPNSVLTEHKGLHAEKESLIGNECEEFNQNTYLSKDAEIP
PGEKHYESNDFSDLLSFHSLLTQHHTTHLGKLSHGYVECGAAFSCYSFFTQPQRIHSREK
PYACNDCGKAFSHDFFLSEHQRAHTGEKPYECKECNKAFRQSAHLAQHQRIHTGEKPFAC
NECGKAFSRYAFLVEHQRIHTGEKPYECKECNKAFRQSAHLNQHQRIHTGEKPYECNQCG
KAFSRRIXXXXXXXXXXGEKPFCNECGKTFGYRSHLNQHQRIHTGEKPYECIKCGKFFRT
DSQLNRHHRIHTGERPFECSKCGKAFSDALVLIHHKRSHAGEKPYECNKCGKAFSCGSYL
NQHQRIHTGEKPYECNECGKAFHQILSLRLHQRIHAGEKPYNCNECGNNFSCASALRRHE
KIHNREAL
Download sequence
Identical sequences ENSTTRP00000013074 ENSTTRP00000013074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]