SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013140 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013140
Domain Number 1 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-21
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 389-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 622-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-20
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 7 Region: 542-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013140   Gene: ENSTTRG00000013857   Transcript: ENSTTRT00000013857
Sequence length 676
Comment pep:novel genescaffold:turTru1:GeneScaffold_3266:379487:388235:-1 gene:ENSTTRG00000013857 transcript:ENSTTRT00000013857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVTFGDVAVHFSREEWQCLDPGQRALYKEVMLENHSSVAGLAGFLVFKPELISRLEQG
QEPWVLDLQGAEGREAARTSQADSTIGTESEQACEDIDRLKSESHVVMVKTPSQDFPQSP
GFGDASDPEVCSESQPTSLFQKNCLNIGTVAPRETFAEEAQGCGERGSGRLCRXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXKPFKCTECGKAFRLSSKLIQHQRIHTGEKPYRCE
ECGKAFGQSSSLIHHQRVHTGERPYGCRECGKAFSQQSQLARHQRTHTGERPYPCQECGK
AFSQSSTLAQHQRMHAGEKLQLPRAPDSPSLVAHQRLHATEKPFKCDECGKAFRWVSRLS
QHQLTHTGEKPYKCNKCSKAFGCSSRLIRHQRTHTGEKPFKCEECGKGFVQGSHLIQHQR
IHTGEKPYECSDCGKAFSQSSSLIYHQRIHKGEKPYECLECGKAFSMSTQLTIHQRVHTG
ERPYKCSECGKAFSQNSTLFQHQIIHAGVKPYGCSECGKAFSRSSYLIEHQRIHTRAQCY
HEYGTLEASTHVSRKKVNTVKKLHKCNECEKIFRWRSHLIIHQRIHTGEKPYKCNECGKA
FNRSSRLTQHQKIHMG
Download sequence
Identical sequences ENSTTRP00000013140 ENSTTRP00000013140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]