SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013143 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013143
Domain Number 1 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 17-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 502-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.73e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013143   Gene: ENSTTRG00000013860   Transcript: ENSTTRT00000013860
Sequence length 561
Comment pep:novel genescaffold:turTru1:GeneScaffold_3266:431099:442296:-1 gene:ENSTTRG00000013860 transcript:ENSTTRT00000013860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARLLPPPAVPQPLSFQAKVTFEDVAVLLSQEEWDRLGPAQRGLYRHVMMETYGNVVS
VGIPGSKPEVISQLERGEEPWVLDKQGNEGRRGLGTGRSDNFTYDHMTACVQQDSTSCPW
GCENTERDQSRALSLRPLTSQEAPTALRKTPAEWSDQGSCEPEESFCLSPSHAGPPEGRA
LSQGMPVAQRPAVPGGERPYRCVECGKCFGRSSHLLQHQRTHTGERPYVCGVCGKAFSQS
SVLSKHRRIHTGEKPYACHECGKAFRVSSDLAQHHKIHTGEKPHECLECRKAFTQLSHLL
QHQRIHTGERPYVCGVCGKAFNHSTVLRSHRRVHTGEKPHACAECGRAFSVKRTLLQHQR
VHTGEKPYACGECGRAFSDRSVLIQHHSVHTGEKPYECSECGKAFRHRSTLLNHERIHTE
EKPYGCYACGKAFVQHSHLTQHQRVHTGEKPYVCSECGHAFSARRSLVQHQRVHTGERPF
RCAQCDKAFSLKATLIVHLRTHTGERPYECSRCGKAFSQYSVLVQHQRIHTGERPYECGE
CGRAFNQHGHLIQHQKVHRKL
Download sequence
Identical sequences ENSTTRP00000013143 ENSTTRP00000013143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]