SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013391 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013391
Domain Number 1 Region: 296-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 201-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.48e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 122-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000242
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000484
Family KRAB domain (Kruppel-associated box) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013391   Gene: ENSTTRG00000014123   Transcript: ENSTTRT00000014120
Sequence length 359
Comment pep:novel scaffold:turTru1:scaffold_115026:16952:19710:1 gene:ENSTTRG00000014123 transcript:ENSTTRT00000014120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLEDPVTFGDVAQYLLREWLRLDPEQRTPAYRNVTSVAGVPVLNPDLVSHLVQSDPSPRV
DRAEHSESIWVTQPPRMGEVAQSQEMASTSSPTASEHSPEVKQNGDSEGRGGSPQNLPVE
HHFACKECGDAFRLKVLLVQHQRIHSEEKGWECGDCGQAFRGVSEFNEHRKSHVAAEPRP
GPSRALDEAVEKREQMEREAKPFECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGRSF
KVNTHLFRHQKLHTSEKPFACKTCGRDFLDRQEFLKHQRMHTGHLPFDCDDCGKSFRGVN
GLAEHQRIHSGAKLYGCSHCGKLFRRSSELTKHRRIHTGEKPYECSQCGKAFRQSSSLL
Download sequence
Identical sequences ENSTTRP00000013391 ENSTTRP00000013391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]