SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013604 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013604
Domain Number 1 Region: 157-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.64e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 212-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 367-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-21
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 9 Region: 455-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 10 Region: 599-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000317
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013604
Domain Number - Region: 418-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0164
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013604   Gene: ENSTTRG00000014352   Transcript: ENSTTRT00000014349
Sequence length 627
Comment pep:novel genescaffold:turTru1:GeneScaffold_1467:57325:67525:1 gene:ENSTTRG00000014352 transcript:ENSTTRT00000014349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSPPPEPKGLLTFEDVAVFFTQEEWDYLDPAQRSLYKDVMMENYGNLVSLDVLNRDK
DEEPTVKQEIEEIEEEVEPQGVIVTRIKSEIDQDPMGRETFELVGRLDKQRGIFLWEIPR
ESLTQEQRMFRGNTSIIRKRPNSEEKCHKCEECGKGFVRKAHFIQHQRVHTGEKPFQCNE
CGKSFSRSSFVIEHQRIHTGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNQCKQS
FSQRRSLVKHSIRIHTGEKPHKCSDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSR
NSLLVEHQRIHTGERPHKCGECGKAFRLSTYLIQHQKIHTGEKPFLCIECGKSFSRSSFL
IEHQRIHTGERPYQCKECGKSFSQLCNLTRHQRIHTGDKPHKCEECGKAFSRSSGLIQHQ
RIHTREKTYSYNETKESFDPNCNLIIQQEVYPKEKSYKCDECGKTFSVSAHLVQHQRIHT
GEKPYLCTVCGKSFSRSSFLIEHQRIHTGERPYLCRQCGKSFSQLCNLIRHQGVHTGNKP
HKCDECGKAFSRNSGLIQHQRIHTGEKPYKCEKCDKSFSQQRSLVNHQKIHAEVKIQETH
ECDACGEAFNCHISLIQHQKLHTTWMQ
Download sequence
Identical sequences ENSTTRP00000013604 ENSTTRP00000013604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]