SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013612 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013612
Domain Number 1 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.61e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-25
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 218-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-24
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 6 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 542-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 180-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000702
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013612   Gene: ENSTTRG00000014354   Transcript: ENSTTRT00000014357
Sequence length 615
Comment pep:novel scaffold:turTru1:scaffold_82271:11161:17361:-1 gene:ENSTTRG00000014354 transcript:ENSTTRT00000014357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLMTFEDVAVDFTQEEWQYLNPPQRNLYRDVMLETYSNLVSVGQQVTKPDLILKLEVEEP
CLPEGKIPIWSFPEACQVDEQFERQHQDDQDKYLMQVGFPDRKTITTKSGLDYNEFGNIL
HLNTNLVASIQRPHKFESFGYNMVDNLDLFSRSSAGKKHDNECAKLFFHTEYEKTTPGVK
PYGYKECGKTLRQKKGLSLHQRIKNGEKPFECTACRKTFSKKSHLIVHWRTHTGEKPFGC
TECGKAFSQKSQLIIHLRTHTGERPFECPECGKAFREKSTVIIHYRTHTGEKPYECNECG
KAFTQKSNLIVHQKTHTGEKTYECTKCGESFIQKLDLIIHHSTHTGKKPHECNECKKTFS
DKSTLIIHQRTHTGEKPHKCMECGKSFNEKSTLIVHQRTHTGEKPYECDVCGKTFTQKSN
LGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGHTGEKPYECNECEKAFSQKSYLIIH
QRTHTEEKPYKCNECGKAFREKSKLIIHQRIHTGEKPYECPVCWKAFSQKSQLIIHQRTH
TGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKSNLIVHQRTHTGKK
AHGKGHTRKSKLIAH
Download sequence
Identical sequences ENSTTRP00000013612 ENSTTRP00000013612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]