SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013690 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013690
Domain Number 1 Region: 120-281,409-558,597-686
Classification Level Classification E-value
Superfamily Ras GEF 2.88e-97
Family Ras GEF 0.0015
Further Details:      
 
Domain Number 2 Region: 801-895
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.3e-42
Family Ras-binding domain, RBD 0.00000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013690   Gene: ENSTTRG00000014436   Transcript: ENSTTRT00000014436
Sequence length 926
Comment pep:novel genescaffold:turTru1:GeneScaffold_2450:303553:352670:-1 gene:ENSTTRG00000014436 transcript:ENSTTRT00000014436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSSGRARCRQWESRWRRRWRWRSPGPGGDGRPLHEPRIRAPPCDARGPRPAAFASPGPRP
GAGDVLPGLRMMVDFQSSTQEIGEELVNGVIYSISLRKVQVHHGANKGQRWLGYENESAL
NLYETCRVRTVKAGTLEKLVEHLVPAFRGSNLSYVTIFLCTYRAFTTTQRVLDLLFQRYG
RCDALTASSRYGCILPYSSEDGGPQDQLKNAVSSILGTWLDQYSEDFCQPPDFPCLKQLV
AYVQLNMPGSDLERRAHLLLAQLERTELTKAEPEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELFKKV
VPYHCLGSIWSQRDKRGKEHLAPTVRATVAQFNSVANCVITTCLGDRSVTARARARVLEH
WIEVARECRVLKNFSSLYAILSALQSNSIHRLKKTWEEVSRDSLRIFQKLSEIFSDENNY
SLSRELLIKEGTSKFATLEMPKRAQRPMSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGR
LINFEKRRKEFEVIAQIKLLQSACNNYSIAAEEHFGAWFRAMERLSEADSYSLSCELEPP
SESASNTLKVKKNTAIVKRWSDRQAPSTELSTGSSCHSKSCDQLRCGPYLSSGDIADALS
VHSAGSSSSDVEEITMSFVPESPDGQEKKFWECTSQSSPETSGISSASSSTSSSSASTTP
VATTRTHKRSVSGVCSYSSSLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAV
IRKAMDKHNLDEDEPEDYELVQVISDDRKLKIPDNANVFYAMNSTANYDFVLKKRTFTKG
AKVRHGASSTLPRMKQKGLKIAKGIF
Download sequence
Identical sequences ENSTTRP00000013690 ENSTTRP00000013690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]