SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013725 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013725
Domain Number 1 Region: 56-365,664-911,967-1067,1097-1120,1553-1616
Classification Level Classification E-value
Superfamily ARM repeat 1.27e-44
Family PBS lyase HEAT-like repeat 0.083
Further Details:      
 
Domain Number 2 Region: 2695-3070
Classification Level Classification E-value
Superfamily ARM repeat 0.000000633
Family GUN4-associated domain 0.074
Further Details:      
 
Domain Number 3 Region: 7-48
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000575
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013725
Domain Number - Region: 1350-1660,1709-1722,1842-1953
Classification Level Classification E-value
Superfamily ARM repeat 0.00504
Family Mo25 protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013725   Gene: ENSTTRG00000014476   Transcript: ENSTTRT00000014476
Sequence length 3104
Comment pep:novel genescaffold:turTru1:GeneScaffold_3325:14751:145131:1 gene:ENSTTRG00000014476 transcript:ENSTTRT00000014476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FESKSQQQQQQQQQQQLHQQPPQAQPPLPQSPPPPPPPPPPPPGPAVAEEPLHRPKKELS
ATKKDRVNHCLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNK
VIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCL
TRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKCSSPTVRRTAAGS
AVSICQHSRRTQYFYSWLLSVLLGLLVPVEEERSALLILGVLLTLRYLVPLLQQQVKDTS
LKGSFGVTRKEMEVSPSTEQLVQVYELTLHYTQHQDHNVVTGALELLQQLLRTPPPELLR
VLTTAGGIGQLTAAKDEPGCRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLFGEAAALED
DSESRSDGSSPTFSASVKGEIGGELAASSGVSTPGSAADSVGHDIITEQPRSQHTLQTDS
VDLTGCDLTSGATDGDEEDILSHSSSQISAVPSDPAMDLNDGTQASSPISDSSQTTTEGP
DSAVTPSDSSEIVLDGADSQYPGMQVGQPQDVDEDAAVVLPDEDAEFRNSSIALQQAHLL
QSMGHSRQPSDSSIDKFVSRDEAAEPGDPENKPCRIKGDIGQSSDEDSAPLVHCVRLLSA
SFLLTGEKHALVPDRDVRVSVKALALSCVGAAVALHPESFFGRLYRAPLDTMEYPEEQYV
SDILNYIDHGDPQVRGATAILCGTLVSSILSRSRFHVGDWMGTVRTLTGNTFSLADCIPL
LQKTLKDESSVTCKLACTAVRLCVMSLCSSSYSEWGLQLLTDMLALRSSSYWLVRTELLE
TVAEIDFRLVSFLEAKAENLHRRAHHYTGLLKLQERVLNNIVIYLLGDEDPRVRHVAAAS
LTRLVPKLFYKCDQGQADAVVAMARGQSSVHLKPLMHEAQPPSHFSASTITRIYRGYNLL
PSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFPVCIWSLGWHCGVP
PLSASDESRKSCTVGMVTMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPRSLRSPWA
SEEEAGPAATRQEEVWPALGDRTLVPMVEQLFSHLLKVVNICAHVLDDVAPGPAIKAALP
SLTNPPSLSPIRRKGKEKEPGEQVSVPVSPKKGGEASPASRPSETSGPVAATKSSSLGSF
YHLPSYLKLHDVLKATHANYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCV
EEILGYLKSCFSREPVMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSV
RPGLYHYCFMAPYTHFTQALADASLRNMVQAEQDHDTSGWFDVLQKVSTQLKTNLTSVAK
NRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVNYCLLDSDQV
FIGFVLKQFEYIEVGQFRESEAITNIFFFVGLLSYESYHSKQIIGIPKIIQLCDGIMASG
RKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILV
LQQCHKESEDKWKRLSRQVADIILPMLARQQMHIDSHEALGVLNTLFEILAPSSLRPVDM
LLRSMFVTPDTLASVSTAQLWIAGILAILRVLISQSTEDIVLSRIQELSFSPYLLCCPII
NRLRDGGSNSVLEEHSEGRQTKDLPEETFSRFLLQLVGILLEDIVTKQLRVEMSEQQHTF
YCQELGTLLMCLIHIFKSGTFRRITAAASRLLTDGADGSFYGLESLNAWVRSMVPTHPAL
VLLWCQILLLVSHTDYRWWAEVQQTPRRRSLSSTKSLSPQMSGEDEDSDVASKLGMCNRE
IVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNSAASGL
FIQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLTLYVDKLLCTPFRVLAHMVDTLA
CRRVEMLLAANLQNSTAQLPAEELSRIQEHLQSSGLAQRHQRLYSLLDRLRLATAPASRG
PAPLVTPHPLDGDGPLALETVSPDKDWYVRLVKSQCWTRSDSALLEGAELVNRIPPGDLN
AFMMNSEFNLNLLAPCLGLGVREICAGRKSPLFAAARTATLDRVASVVQQLPAVHHVFQP
FLPAEPTAYWSKLDDLFGDAVLYRTLTTLARALAQYLLVFSRLPSHLHLPPEKERDTVKF
VVMTLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSLLSSPEMVTHACSLIHCVR
FILEALVVQPGDQLLSPERRTNTPQAAREDEVDANTQNPQYVTAACGMVAEMVEALPLVL
ALGHKRNSSAPAFLTPVLKNIVISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTVFPE
IPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTE
RTQIHVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALGTRFGRKLSIIRGIV
EQEIQAMVSKRENIATHHLYQAWDPIPSLSPATTGALTSHDKVLLQVNPERELGNTSYNL
GQVSIRSVWLGSSVTPLREEEWAEEEEAPAPSSPPTSPVSARKHRAGVDIHSCSQFLLEL
YSRWILPSSSARRTPVILISEVVRSLLVVSDLFTERSQFETMYLTLTELRRVHPSEDEIL
QQYLVPATCKAAAVLGMDKAVAEPVSRLLESTLRSGHLPSRIGALHGVLYVLECDLLDDT
AKQLIPVISDYLLSNLKGTAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQM
CGVMLSGSEESTPSIVYHCVLRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAA
LGLMLTCMYTGKEKISPGRTSDPSPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVAR
ILPQFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMATVVYQVFQTLHSTGQSSMVRDWVML
SLSNFTQRTPVAMAMWSLSCFFVSASTSPWVSAILPHVVSRMGKLEHVDVHLFCLVAADF
YRHQIEEELDRRAFQSVFEVVAAPGNPYHRLLACLRNVHKVTTC
Download sequence
Identical sequences ENSTTRP00000013725 ENSTTRP00000013725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]