SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013768 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013768
Domain Number 1 Region: 46-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.6e-38
Family SCAN domain 0.0000617
Further Details:      
 
Domain Number 2 Region: 645-702
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 589-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.33e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 6 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 383-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 687-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013768
Domain Number - Region: 226-286
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000471
Family KRAB domain (Kruppel-associated box) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013768   Gene: ENSTTRG00000014521   Transcript: ENSTTRT00000014521
Sequence length 756
Comment pep:novel scaffold:turTru1:scaffold_92605:13431:23819:-1 gene:ENSTTRG00000014521 transcript:ENSTTRT00000014521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQGRGTSGLIPRGAVLQRQEGRLTVKQEPESQSWGQGCSLQKNHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHVSGPGEVSAPAQEQEMHLEEMTALGATEESPPTSLLSEGSAPGAH
LEPPGDPGAHHHLPSGHSAQHASPVPALPQVGNVGDQAAATVLRMVRPQEAAEFEFLSVD
YTQKKWKGPALSQKAALYRNIVPENCCSLASLAGENRMESSELPPKQEISEETESSDRTS
GVLYGVIPGGPEAGDACEEALEKLEVQPSGKQGSRLKSDFLEITQEVKNKCTKDECDVYK
ELEEHPDLSSSPAEHQEILKGQKFYHCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGK
TFRQTSQLIVHLRIHTGEKPYECSDCGKTYRHSSHLIQHQRLHNGEKSYKCNECAKAFTQ
SSQLIDHQRTHTGEKPYECNDCGEAFIRSKSLVHHQVLHSGEKPYKCNECGKAFCSNRNL
IDHQRIHTGEKPYECNECGKAFSRSKCLIRHQSLHTGEKPFKCSECGKAFNQNSQLVDHE
RIHTGEKPFECNECGKAFSLSKCLIRHQRLHTGEKPYKCKECGKSFNQNSHLIIHQRIHT
GEKPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCKDCEKAFSDSSQLIVHQRVHTGEKP
YECIECGKAFSQRSTFNHHQRTHTGEKQSGLARSVF
Download sequence
Identical sequences ENSTTRP00000013768 ENSTTRP00000013768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]