SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013811 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013811
Domain Number 1 Region: 291-348
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000018
Family beta-sandwich domain of Sec23/24 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013811   Gene: ENSTTRG00000014564   Transcript: ENSTTRT00000014564
Sequence length 575
Comment pep:novel scaffold:turTru1:scaffold_92833:238704:254802:-1 gene:ENSTTRG00000014564 transcript:ENSTTRT00000014564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQNNSYPPMSDPYMPSY
YAPSIGFPYSLGEAAWSTAGDQPMPYLITYGKRIVGEDHYIPEGVFILPRRLRNTPPYRC
QNGSNFFPGNADFSTWGTSGSQGQSTQSAYSSSYGYPSSLGRAITDGQAGFGNDTLSKVP
GISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIAANSVPPVSSAAPKPTSWAAIA
RKPAKPQPKLKPKGSVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPAAQPVLPPQTLVQ
QPQPLIQPPPLVQGQLPPPQPQPQAGAQPQAQPHQAQPQPQPQPLQNRWLAPRNRGAGFH
QNSGGGGENFGLGVVPASASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFIIKSYS
EDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDY
NAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQ
VLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRRVR
Download sequence
Identical sequences ENSTTRP00000013811 ENSTTRP00000013811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]