SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013870 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013870
Domain Number 1 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-27
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 553-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 497-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 595-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 637-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-17
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 10 Region: 180-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.47e-17
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 11 Region: 320-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000033
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 404-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000192
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013870   Gene: ENSTTRG00000014627   Transcript: ENSTTRT00000014627
Sequence length 681
Comment pep:novel scaffold:turTru1:scaffold_83516:14390:24160:-1 gene:ENSTTRG00000014627 transcript:ENSTTRT00000014627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETVTFKDVAIDFTEEEWQQLDPAQRNLYWNVMLENYNNLITVGCPFTKPDVIFKLEQEEP
WVVEEEVSKRHCPGEIWGMDEHQKIQDRLLTQLEDKFTKTLTEEKVNECHKKFANAFSPN
SDFFPSSHNLYKYDLFGKCLEHNNFNYYNNERILIRKEHCEYNEPMKSFGNSLSHLVVTP
FKCNHCGKGFDQTLDLIRHLRIHTGEKPYECKKCRKAFSQKEKLIKHHKIHSREQSYECN
ECGKAFIKMSNLIRHQRIHTGEKPYACKECGKSFSQKSNLIDHEKIHTGEKPYECNECGK
AFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCGKAFSQ
FSMLIIHVRIHTGEKPYECNECGKSFSQSSALTVHMRSHTGEKPYECKECRKAFSHKKNF
ITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSNLIAHE
KIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNECGKAFSQIASLTLHLRSHT
GEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGHTGEKP
YECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEKPYHCN
ECGKAFSQKSHLVRHQRIHTH
Download sequence
Identical sequences ENSTTRP00000013870 ENSTTRP00000013870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]