SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013989 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013989
Domain Number 1 Region: 23-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-23
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 2 Region: 316-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000264
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 3 Region: 270-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000738
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 233-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000517
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013989   Gene: ENSTTRG00000014754   Transcript: ENSTTRT00000014753
Sequence length 377
Comment pep:novel scaffold:turTru1:scaffold_89196:13385:21284:1 gene:ENSTTRG00000014754 transcript:ENSTTRT00000014753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLADVNLPQRPQVLGSEERDGSCEGSVSFEDVTIDFSREEWQQLDPAQRRLYQDVMLEIY
SHLFSVGYRIPNPEIIFRMEKRKEQWMREAELPRQRYHEGESGLETLQWEISETASFHNE
MLDEVTRDGTWCSILEKLWEEADQTKRDQKNQSKPSHQGAFLNKKKLNTERDRNYKDPGK
IIHARPHLVSSQKRPRKRCSRAKSLKPNLEVNHQNQSNTTEYLDEMVESGQLFTHSSSSA
SCKNTHTGENFCEGNSCTKGFGHKQSFTQHQVHTQEKPDKCTECGRDFTQKSHLLEQQRF
HSVENLQECGKCGRAFTPQPKLGVYVTDHTGNIPYICECGKVFVQRPELVTHQKTHTRKK
PHKCHECGKAFFQMLSL
Download sequence
Identical sequences ENSTTRP00000013989 ENSTTRP00000013989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]