SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014137 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014137
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.59e-17
Family Ubiquitin-related 0.0000187
Further Details:      
 
Domain Number 2 Region: 235-329
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000105
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014137   Gene: ENSTTRG00000014917   Transcript: ENSTTRT00000014911
Sequence length 388
Comment pep:novel genescaffold:turTru1:GeneScaffold_2671:183657:185510:1 gene:ENSTTRG00000014917 transcript:ENSTTRT00000014911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTVYCVRRDLSEATFSLQVSPDFELHNFRVLCELESGIPAEEIQIVYMERLLAYDHCS
LGSYGLKDGDMVVLLHKENVGPRPLGQTSSLPQSDFTGTAVPGTSSSRQHHQHQRAQSAQ
QSRGLYSGKMTSAQGLDSSTLIRNMVLSNSHDLSLLEEYNPPADALLRGDLEKSFRILVE
QQQDRAWREQERIHLFSVDPFAQAKIEEDIRQQNIEENMTIAMEEGLESFCVVVLYINCK
VNGHPLKGFVDSGAQMTSISQACAERCNIGLDKKCLWFVKLKDTFFHFHQTLEQCIHDFL
QCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGTQTYFLPEGELPPCAKLVS
ETGQDESSDKEIADTIKHSVMDSGRKKH
Download sequence
Identical sequences ENSTTRP00000014137 ENSTTRP00000014137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]