SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014177 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014177
Domain Number 1 Region: 84-386,493-529
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.74e-56
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 367-473
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.2e-27
Family L-aminoacid/polyamine oxidase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014177   Gene: ENSTTRG00000014953   Transcript: ENSTTRT00000014954
Sequence length 582
Comment pep:novel genescaffold:turTru1:GeneScaffold_645:73229:82721:-1 gene:ENSTTRG00000014953 transcript:ENSTTRT00000014954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNDDFCPGLTRKAMGAERARQSQPCSWRLLALVPILLSLAASLDRQTAQSRDPFEKCMR
DPDYEQLLRVLTLLNRTSKPQRTVVGAGVGLLAAKVLSDAGHKVTILEADNRIGGRIFTY
RDRKTGWIGELGAMRMPSSHRILHALCKSLGLNLTKFTQYDENTWTEVHEVKLRNYVVEK
MPEKLGYKLHPKEKGHSPEEIYQMALNRAIEDLRTLGCRKAMMKFERHTLLEYLLGEGNL
SQPAVRLLGDVMSKDGFFYLNFAEALRAHSCLSDRLRYSRIAGGWDLLPRALLSSLSGPV
LLHTPVVAIKQGTHEVSVYFEPSRRARNQKSLTADVVLLTVSGPALQRITFTPPLTLKWQ
EAVRALHYMPATKVFLSFRRPFWHDEHIEGGHSNTDRPSRVIFYPPPGEGALLLASYTWS
DAAATFAGLSLSEALRLALDDVAALHGPIVYRLWDGSGIVKRWAEDPHSQGGFVVQPPML
WRTDKDEDQEYDWAVPHGRIYFAGEHTAYPHGWVETAVKSALRAAVLINGRPAAGTTPIN
SMGHVHVAPAHHHPRSLERGRGTHSPALHPSPLHTTQKRTEY
Download sequence
Identical sequences ENSTTRP00000014177 ENSTTRP00000014177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]