SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014386 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014386
Domain Number 1 Region: 439-685
Classification Level Classification E-value
Superfamily vWA-like 5.34e-69
Family Trunk domain of Sec23/24 0.00014
Further Details:      
 
Domain Number 2 Region: 198-456
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.97e-38
Family beta-sandwich domain of Sec23/24 0.0044
Further Details:      
 
Domain Number 3 Region: 687-782
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.22e-36
Family beta-sandwich domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 4 Region: 889-1030
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.92e-32
Family C-terminal, gelsolin-like domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 5 Region: 783-888
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.89e-29
Family Helical domain of Sec23/24 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014386   Gene: ENSTTRG00000015168   Transcript: ENSTTRT00000015174
Sequence length 1034
Comment pep:novel genescaffold:turTru1:GeneScaffold_2347:359318:466056:-1 gene:ENSTTRG00000015168 transcript:ENSTTRT00000015174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPPYSQSQPGIGLSPPHYGHYGDPSHTGSPPGMMKPAGPLGAAAPGGMLPQG
HPPHGPHQFGQNGAHAQGPPLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSGMAPPSQGPPGPPSAAAAFQGPSRSPQPSILQPGSQVLPPPPTALN
GPGASPLPPSTHRQDGLPGPAPPNAQYQPPPLPGQTLGPGYPLQQAANYGPQMAGAQLSY
PGGFPGGPAQMAGPPQPQKKLDPDSIPSPIQVIENDRATRGGQVYTTNTRGQIPPLVTTD
CTIQDQGNASPRYIRCTTYCFPCTSDMAKQAQIPLAAIIKPFATIPSNETPLYLVNHGET
GPVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELS
LGSYEYVATLDYCRKNKPPSPPAFIFMIDVSYSNIKNGLVKLICEELKTVLEKLPKEDQE
ETSSLRVGFITYNKVLHFFNVKSTLARPQMMVVTDVSEVFVPLLDGFLVSYQESQSVIHN
LLDQIPEMFADSNENETVFAPVIRAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDD
KKLINTDKEKILFQPQTNVYDPLAKDCVAHGCCVTLFLFPSQYVDVASLGLVPQLTGGTL
YKYNNFQVHLDSQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGIYMNNTTDVEM
AAIDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTVSGQRRLRIHNLGLNCSSQLADLYK
SCETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHVLACYRKNCASPSAASQLILPDS
MKVLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLRPIHTLDVK
STTLPAAIRCSESRLSEEGIFLLANGVNMFLWLGVSSPPELIQGIFNVPSFAHVNTDITS
LPELGNPYSQTLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVD
FLCCVHKEICQLLN
Download sequence
Identical sequences ENSTTRP00000014386 ENSTTRP00000014386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]