SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014602 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014602
Domain Number 1 Region: 544-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-17
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 60-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-16
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 3 Region: 259-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000175
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014602   Gene: ENSTTRG00000015409   Transcript: ENSTTRT00000015407
Sequence length 593
Comment pep:novel genescaffold:turTru1:GeneScaffold_413:10641:19269:-1 gene:ENSTTRG00000015409 transcript:ENSTTRT00000015407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLPDPSAWREQDWEEMLPLENREVAETVKTPTQNHKAKGLPSHKTDWLQEKEGKVQILV
PVTFRDVAVVFTEAEWKRLSSEQRDLYREVLLENYRNLLSAEPKPEIYPCSSCLLAFFCQ
RFLSHTLQIFPGVCVENHFHLGDSGLGHRGQQYSAHSCWSENTEGQEKEGDSRLWCSRTE
ERRPLRALPSPPEQSASPGEGSAVVEIEPSAAQRVNPLQADKEMKELETSSSGAVNCQER
ELDCSPKSNCITNQTILLGEKPYVCRECGRGFKDKSNLIRHHWTHSMQNAYVYSECGRSF
SQVSTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXMCKECGWGFSQKSLLLVHQRTHSGEKYYVCRECGRGFSNKSSLIRHQRTH
Download sequence
Identical sequences ENSTTRP00000014602 ENSTTRP00000014602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]