SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014615 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014615
Domain Number 1 Region: 358-551
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.03e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000905
Further Details:      
 
Domain Number 2 Region: 81-184
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000524
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 196-275
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000999
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014615   Gene: ENSTTRG00000015420   Transcript: ENSTTRT00000015422
Sequence length 1190
Comment pep:novel genescaffold:turTru1:GeneScaffold_1500:58291:201351:-1 gene:ENSTTRG00000015420 transcript:ENSTTRT00000015422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMSPQQETLGGQPARSSSLTGVSRIAGAPGTKKKMKTLAERRRSAPSLILDKALQKRP
STKESPSASVDTCAFLSSFLCSNRTLLIDGRVELKRGLQRQERHLFLFNDLFIVAKIKYN
NNFKIKNKIKLSDMWTASCVDEVGEGNTNALKSFVLGWPTVNFVATFSSPEQKDRWLSLL
QRYINLEKEKDYPKSIPLKIFAKDIGNCAYSKTITVTNSDTANEVINMSLPMLGITGSER
EYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDTTLLTQGSKDSPTPSNFQEPFLMEQLP
REMQCQFILKPSRLAVAQQLSDSGQKTFKRRRSIINWAFWRGSSTHLDNLPMSPTSPVPG
QLFGVSLPNICENDNLPKAVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGAEV
QLDCESIFVIASVLKDFLRNIPGSTFSSDLYDHWVCVMDQGNDEEKINAVQRLLDQLPRA
NVILLRYLFGVLYNIEQHSSSNQMTAFNLAVCIAPSILWPPTSSSPELENEFTKKVSLLI
QFLIENCCRIFGEEITSLLGEVSVRCDTRENASDISCFQLNDSSYDSLENELNEDVDAPC
SDLVKKLGQGSRSMDSVLTLSDYDLDQPEVEGLLTLSDFDLDHSKDEDIQMEQPLESKPV
NIAVYTKEPLQDHARGPSGMSTPSHLSTTAADAPKSLRRHRRCSEPSYDYLDSKLSYLRE
FYQKKLRKSSCDAVLSKKDESHLNQNQPLQEEGKTCFKKSLVIGTDIKKNATNKNVKKKS
LSDNEGNHVKLFPKSKPVAISMASYSHMSSCDHPRNQTFDTDTSGYSPPHTTDALKSSRR
HRRCSEPNIDDQHCKLTYLRGIHSKKQHKASYEASLLHGEEDYLKRHKSLQMEGQKLINQ
SLVMGIEVGKTSATNQNTEKVLPPRLNICSRTSYSSLSSPGTSPSGSSVSSQDSVFSQIS
EHSVFTPTETSSPIDCTFQAQRKQEELSSDFSSSSLISGIPGPSSGQASGHLAYTKKDSV
EWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKARAPRPEENKIGSLKGHTEPPPQASGVP
EANALHERQKDMPQGVAEGLGAVQTARWYSSYPSQDSEKHCSSPVSLVEDRLGLCMKSPE
EGEISGRCSPGTLPHGRSSPSSLTVDHVCSPDSGPTVVCDVEDRHLTKDI
Download sequence
Identical sequences ENSTTRP00000014615 XP_019797483.1.83887 ENSTTRP00000014615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]