SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014693 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014693
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-28
Family Ubiquitin-related 0.00000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014693   Gene: ENSTTRG00000015516   Transcript: ENSTTRT00000015507
Sequence length 117
Comment pep:novel genescaffold:turTru1:GeneScaffold_1305:462459:474694:-1 gene:ENSTTRG00000015516 transcript:ENSTTRT00000015507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNSDICVSMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRL
IYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Download sequence
Identical sequences ENSTTRP00000014693 ENSTTRP00000014693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]