SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014750 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014750
Domain Number 1 Region: 61-194
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-19
Family Ankyrin repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 6-68
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000964
Family Ubiquitin-related 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014750   Gene: ENSTTRG00000015570   Transcript: ENSTTRT00000015566
Sequence length 237
Comment pep:novel genescaffold:turTru1:GeneScaffold_1139:16833:25785:-1 gene:ENSTTRG00000015570 transcript:ENSTTRT00000015566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFRVTGCRSDMTVRELKEELDLIAGIPFSLQRLQYLDQGILMDDATLRCHDVVPGGIISL
RIWHYDGWTELVLAAVEGDSSKLSCLGVAEDAFHRTTNSQHFDDKQWKKWISQRAFMALY
VASHRGRSEAVQYLLEHGANCQGRSPVGRTPLHVAAAMSRLDCISLQLNYEASINDRDTK
GETPMSLACRLNRSSRWWMFLFYWMVKLGTKDPMDPVVNKAFQRVKAGFGSKKENKT
Download sequence
Identical sequences ENSTTRP00000014750 ENSTTRP00000014750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]