SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014753 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014753
Domain Number 1 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 429-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.38e-22
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 25-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 350-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000442
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014753
Domain Number - Region: 159-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000119
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014753   Gene: ENSTTRG00000015573   Transcript: ENSTTRT00000015569
Sequence length 488
Comment pep:novel genescaffold:turTru1:GeneScaffold_372:46010:53018:1 gene:ENSTTRG00000015573 transcript:ENSTTRT00000015569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALRNPPQXXXXXXXXXXXXXACVTFEDVAIYFSQEEWGLLDEAQRFLYHDVMLENF
ELTTSLDCQCGAEDEEIPSEQSVSGGESQVRTSQSVPSNQKTHPCEKCVSVLKDILQLTE
LQAAYLGQKPYSGGGYASLHQYQEHDNGEKNLKMDVDRSSIVTSCRLHVSGKPFPCGEDG
KDFLATLGLHQHQATPNSEKPHSSIESGEALNNGKSHNKWIECREVFGNTHILHHQRVCT
GEGLDECSKCKYRFVQHQQIHVGERPYECSECGKFFSRKTHLIRHWRVHTGAKPYECSEC
GRSFSQKSDLIQHQRVHTGEKPYECSECRKSFIQKSILIKHQRVHTNERPYKCDQCGKSF
SQSSGLLRHKRAHTRARPYECSECGKAFNCKTHLVRHWRAHTGVRPYECSECGKSFSEKS
VLIQHQRVHTGEKPYECSGCGKAFSQKSVLIQHQRVHTGERPYECSECGKSFSRKTHLIR
HQTVHTGA
Download sequence
Identical sequences ENSTTRP00000014753 ENSTTRP00000014753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]