SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014758 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014758
Domain Number 1 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 396-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 246-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 11-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 199-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000598
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 105-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000624
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014758
Domain Number - Region: 438-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000285
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014758   Gene: ENSTTRG00000015577   Transcript: ENSTTRT00000015576
Sequence length 476
Comment pep:novel genescaffold:turTru1:GeneScaffold_372:63942:70105:1 gene:ENSTTRG00000015577 transcript:ENSTTRT00000015576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NAVAALRDPPQQGSVTLEDVAVYFSWEEWSLLDKAQRHLYHDVMLEIFTLISSLGCLCGI
ENDKAPSGQRVSQERMPQIRTIKPDLSTQKAHLCEMCVPVMKDVLYLAEHQGTYTGQKSC
TCVACGEQFCFRADLDQHQKEHSGEKPCSKGMNRTSFVKSYGIYLSGKPFTCGKGGKDTV
GLFQYQATPKAVLKIHSSTLVHCGKSPYKCGECGKAFRCKRTLVQHQRIHSGGLYECSEC
GKTFTYSTHFRHKTLHTGERPFECSECGKAFRFKYKLVQHQHIHTGERPYECAECGKAFG
CKSKLVRHQRIHTGAKPYECTECGRLFRQSSSLVQHQRIHTGARPYECGECEKSFSQSSS
LIQHRRIHTGERPYECSECGKSFSQSSSLIQHRRVHTGARPYECRECGKSFSQSFSLILH
QRIHTGERPYECSECGKSFSQNYSLIQHHKLHTRRPQEYSQHEKAFSYQSALIQHQ
Download sequence
Identical sequences ENSTTRP00000014758 ENSTTRP00000014758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]