SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014783 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014783
Domain Number 1 Region: 152-273
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.81e-17
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.034
Further Details:      
 
Domain Number 2 Region: 37-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000148
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014783   Gene: ENSTTRG00000015609   Transcript: ENSTTRT00000015603
Sequence length 348
Comment pep:novel scaffold:turTru1:scaffold_108815:17928:19961:-1 gene:ENSTTRG00000015609 transcript:ENSTTRT00000015603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGPAKGGYFGVHPPASYPGGVCQPAAGTKAGPTGVWSVGGRTDTMWRLRCKAKDGTHVL
QGLSSRTRMRELQGQIAAITGIAPGCQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIV
EEDQTRPKMSPAFTKHGAPSYIRETLPVLTRAVVPADNSCLFTSVYYVVEGGVLNPACAP
EMRHLIAQIVASNPDFYSKAILGKTNQEYCDWIKREDTWGGAIEISVLSKFYQCEICVVD
TQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRVFPNPDTPPLTIFSSNDDIVLVQALEL
ADEARSKRQFTDVNRFTLRCMVCQKGLTGHAEARDHAKETGHTNFGEV
Download sequence
Identical sequences ENSTTRP00000014783 ENSTTRP00000014783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]