SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014806 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014806
Domain Number 1 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 225-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-20
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 310-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 42-86
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000248
Family KRAB domain (Kruppel-associated box) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014806   Gene: ENSTTRG00000015632   Transcript: ENSTTRT00000015628
Sequence length 368
Comment pep:novel genescaffold:turTru1:GeneScaffold_3345:29516:31589:1 gene:ENSTTRG00000015632 transcript:ENSTTRT00000015628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGGSQGQELLCCKMALLTPSWGSQSSQFQLMKALLKHESLGPLKMEDVALTLSPERTQL
DSAQVNFYRAEKQENCGSLTSLGGEIWTKIRDPPPDDHPEQEAGQMPCHLGEDTAQTSTC
AEAGAQEGRLQRKQENASGRRWHYCHECGKTFAQSSGLTKHRRIHTGEKPYECEECGKTF
IGSSALIIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSC
SLLEHRKIHTGEKPYQCNVCGKAFRRNSHLLRHQRIHGDKNVQNPDCGETWESQGRMESQ
WENVEAPVSYKCNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLIQHQRSH
AGKKILSP
Download sequence
Identical sequences ENSTTRP00000014806 ENSTTRP00000014806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]