SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014855 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014855
Domain Number 1 Region: 560-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-19
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 3 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 601-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-16
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 6 Region: 406-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000124
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 350-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000224
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 181-191,224-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000219
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014855   Gene: ENSTTRG00000015681   Transcript: ENSTTRT00000015679
Sequence length 685
Comment pep:novel genescaffold:turTru1:GeneScaffold_2077:90410:98212:-1 gene:ENSTTRG00000015681 transcript:ENSTTRT00000015679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLTFEDVAVYFSEQEWRDLEPWQKELYKQVMRTNYEILVSLDDGLPKPELISWLEQGRE
LFRIWGESQKSGNIICTSADLHLDPVIEGQLFVGSQQAVKPGEAHCHFQVDPLQSQRSSE
PFVSFRPDQVVALLNPQRHDTRALVPVVHSSREPTQRDTVVSPRTLGPPGFQETSGEGLQ
HPCPVCGEGFWKNLSEQHQGSHSKGLLHRAWNQFRKQTEAQQPLSIPRGQRHFRCPECGR
GFRRKSCLLRPLSIHPDESQLLGSECEVYAHHLRAGSRPSQCPGCDEARGPPGAEKPGSR
REGAGAASSLRSGEKPGLIQGESARALEPGPGAERPACGPCGQRSSPQCGLPDHTHVHSA
ERPFRCAECGRASRQHGRLRLHRRLQSEEQPFACPECGLGFRLRRHGGERPLSCGECGRD
FAHPCKLREHLRVHSGERPFGCPECGKSFRLKGILKAHERTHSRERPFQCAECGKGFTRP
SKLAEHFRVHSGERPFGCPDCSRRFRLKGQLRSHQRLHTGERPFPCPDCGKSYRVKADMK
AHRLLHGGRMPFSCECGKGFAKQSKLVEHIRTHTGEKPFQCPQCDKSFRLKAQLLSHQGL
HTGERPFRCPECNKNFRERGHMLRHQRIHSPDRPFACADCGKGFIYKSKLAEHIRVHTKS
CRAPSEPDVKQRLSQLFAMIEADWS
Download sequence
Identical sequences ENSTTRP00000014855 ENSTTRP00000014855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]