SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014857 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014857
Domain Number 1 Region: 498-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.23e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 533-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.18e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 138-197
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-17
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014857
Domain Number - Region: 50-121
Classification Level Classification E-value
Superfamily Tropomyosin 0.000915
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014857   Gene: ENSTTRG00000015683   Transcript: ENSTTRT00000015681
Sequence length 641
Comment pep:novel genescaffold:turTru1:GeneScaffold_2077:142406:164549:1 gene:ENSTTRG00000015683 transcript:ENSTTRT00000015681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDAVPAPTSEWDSECLTSLQALPLPTPPAANEAHLQTAAISLWTVVAAVQAIERKVEVH
SRRLLHLEGRTGTAEKKLASCEKTVADLGNQLEGKWAVLGTLLQEYGLLQRRLENLENLL
RNRNFWILRLPPGIKGDIPKVPVTFDDISIYFSTPEWEKLEEWQKELYKNIMKGNYESLI
SMDYAMNQPDVLSQIQPEGDHNTEDQAGPEESEIPTDPTEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXEELVIKAEGLARASLCPEVPVTFSSPPAAAKDTFPDVAFKT
PQSAPMAPFGRPATELAEASEGQVTFTQLGSYPLPPPAGEQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIRHQMIHTGERPYPCPDCSKSFMRKEHLLNHRRLHTGERPFS
CAHCGKSFIRKHHLMKHQRIHTGERPYPCAECGRSFRYKQTLKDHLRSGHGGGCGGRSDP
SGQPPDPPGPLLTGLETAGLGVNTEGLEANQWYGEGTGGGV
Download sequence
Identical sequences ENSTTRP00000014857 ENSTTRP00000014857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]