SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014871 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014871
Domain Number 1 Region: 280-341
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 730-787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 672-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 634-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 544-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 776-828
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000101
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014871   Gene: ENSTTRG00000015695   Transcript: ENSTTRT00000015695
Sequence length 831
Comment pep:novel genescaffold:turTru1:GeneScaffold_2077:303292:324758:-1 gene:ENSTTRG00000015695 transcript:ENSTTRT00000015695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQRSSPLSFPNVVQEETPRQAPAGLPRETLFQSHVLPPKEVPSLSPAIPRQGSLPQTP
SAPKQQTSGRMPHVLQKGPSLLYPAASEQETQIQGPLTSQEEAPYLPPAAAEPEISLLSH
STHHQEAPLHSPEVPERDPLTLSPTVPETDMDPLLQSPVSQKDTPFQISSAAQKDTPLPT
AEITRLAVWAAVQAVERKLEAQAMRLLTLEGRTGTNEKKIADCEKTAVEFANHLESKWVV
LGTLLQEYGLLQRRLENMENLLKNRNFWILRLPPGSNGEVPKVPVTFDDVAVHFSEQEWG
NLSEWQKELYKNVMRGNYESLVSMDYAISKPDLMSQMERGERPAMQEQEDSEEGEAPADP
SAAHDGIVIKIEVQTNDEGSESLETPEPLMGQVEEHGFQDSELGDPCGEQPDLDMQEPEN
PLEASTESSGEFSELKQMLAQQRNCAEGIVIKTEEQDDEDDEDDEDELPQRLQPLGQLSG
RYEAGMYPPPLPGELSPEGEESPPPLQLGNPAVKRLAPPSHGERHPGENRGAASQQQRNR
RGERPFTCMECGKSFRLKINLVIHQRNHIKEGPYECAECEVSFRHKQQLTLHQRIHRVRG
GYASPERGPGFAPKHALKPRPKSPSSGSGGGGPKPYKCPECDSSFSHKSSLTKHQITHTG
ERPYTCPECKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSRPSHLLRHQRTHTGER
PFKCPECEKSFSEKSKLTNHCRVHSRERPHACPECGKSFIRKHHLLEHRRIHTGERPYHC
AECGKRFTQKHHLLEHQRAHTGERPYPCTHCAKCFRYKQSLKYHLRTHTGE
Download sequence
Identical sequences XP_004314416.1.83887 XP_012393642.1.21590 XP_019789472.1.83887 ENSTTRP00000014871 ENSTTRP00000014871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]