SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014875 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014875
Domain Number 1 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 440-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 192-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 32-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000129
Family KRAB domain (Kruppel-associated box) 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014875
Domain Number - Region: 137-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0117
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014875   Gene: ENSTTRG00000015699   Transcript: ENSTTRT00000015699
Sequence length 499
Comment pep:novel genescaffold:turTru1:GeneScaffold_1469:155420:167561:1 gene:ENSTTRG00000015699 transcript:ENSTTRT00000015699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEEGEPPSPDPALPQEEGTEEEGMAGGLLTAGPQGSTPFNSVAVAFTQKGWRQLAPTPK
DRFKKGMPEKSRNLVLLGLPVSQPGMNSQLEQREGSWMLEREGLRSTCSDWKIVSESPPE
QDISEESFQDPSVEMPSGESDYRNSELGKSFNLRPVLSPQQRVPTEVRPHKCETHTESFR
KNSDIIKPHRAKPYICNECGKAFSYCSSLSQHQKSHTGEKPYECNECRKAFSQSSSLTQH
QRIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYKCSECEKAFSDCSALVQHQRIH
TGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEK
PYKCNACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKC
NECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQKIHTGVKPYECSECG
KAFRCSSAFVRHQRLHAGE
Download sequence
Identical sequences ENSTTRP00000014875 XP_004322589.1.83887 ENSTTRP00000014875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]