SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014939 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014939
Domain Number 1 Region: 21-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-18
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 448-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000285
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014939   Gene: ENSTTRG00000015766   Transcript: ENSTTRT00000015764
Sequence length 559
Comment pep:novel scaffold:turTru1:scaffold_110126:28723:40701:-1 gene:ENSTTRG00000015766 transcript:ENSTTRT00000015764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPEEEAATLTMATGPPAERLQEPVTFRDVAVDFTQEEWGQLGPAQRTLYRDVMLETFGH
LLSVGPELPKPEVISQLEQGAELWVAERGIAQGRCPGWESGEGRAPPQEQGLPEEKGREG
FLGEALCPATPGEDWEYEGRVQGPEKDQGNLRQLEFSLKEALVQGGSHEGLRLGENCVLS
PNPNPLPETSRTECLCAPDSWVTSSQQNPSAVGEQMGSLERQPRDNSDCSNSSGQVVLEP
EPEPARSQVPDKPYKCADCGKSFNHNAHLTVHRRIHTGERPYACKECGKAFSQNSSLVQH
ERIHTGHKPYKCADCGKSFCHSTHLTVHRRIHTGEKPYACQDCGRAFNQNSSLGRHRRTH
TGEKPFTCSVCGKAFSRTTCLFLHLRTHTAERPYECSRCGKGFRHSSSLAQHQRKHAGEG
PYDCRQRLAFEPTPAWPEPLPLEGATRSDRPFRCGQCGKCFTQSSHLIRHQITHTREDPR
GRGRRRPQPCSRSPHLGRHQLGPTGESPGAGTKAGQPAGRALALFDIHEIMQEKNPVHVI
GVEEPSVGTSVLFDIREST
Download sequence
Identical sequences ENSTTRP00000014939 ENSTTRP00000014939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]