SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014942 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014942
Domain Number 1 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-23
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 5 Region: 582-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 543-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 333-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-17
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 631-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000803
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014942   Gene: ENSTTRG00000015768   Transcript: ENSTTRT00000015767
Sequence length 676
Comment pep:novel scaffold:turTru1:scaffold_110126:49279:57812:-1 gene:ENSTTRG00000015768 transcript:ENSTTRT00000015767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAYPQQILSQPPVSFKDVAVTFTWEEWGQLDLAQRMLYREVTLETCSHLVSLGLLLSKP
DVIARLEQGEDPWRVEPGPPRDWKTTLENKESASEEGIAVEEPSHHMEMKHCVQEEGPWL
VSLGEVQHWRDQLGKHQEDSLSQTVLTSERHFAQGGSYLSLSLLPPTLPTRTHFHKLNSQ
VKRLKQNSVFINHQKNWADLKSCEDHQSARAFCQSTYLNKIANVETGNKKPYDYTVSSDS
LNCGTSLHFLNRIFSAENGNDSKDDGNSINRSMSLNEHKPMNFGESQYECDECLVQTEIS
DPGEAPFRCEEDCGAFHVASSFPDCDIIQTGKKSYACNQCAKSFSCCSKLVVHKRTHTGE
KPYECTRCGKSFSQSYDLVVHQRTHTGEKPYECNQCGKSFTQSSKLIRHQRTHTGEKPYK
CHECGKSFRWNSNLTVHQRIHTGEKPYECAHCGKSFSQSSDFVAHKRTHTGEKPYECNQC
GKSFIRSTQLIRHLRIHTGEKPYKCNQCDKAFTGSSHLIEHQRTHTGEKPFECNQCGKGF
TGSSHLLHQRXXXGEKPYQCNMCAKAFSQRSRLIEHKRTHTGEKPYECIDCGKAFNIDQP
TKHERTHTGEKPYECNHCEKAFSQRCQLTRHQRIHTGEKPYECNECGKSGSTSLIQHEKT
HGEKPYENQDGKAHCQ
Download sequence
Identical sequences ENSTTRP00000014942 ENSTTRP00000014942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]