SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014947 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014947
Domain Number 1 Region: 222-336
Classification Level Classification E-value
Superfamily Acid proteases 1.91e-27
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 4-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.12e-17
Family Ubiquitin-related 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014947   Gene: ENSTTRG00000015774   Transcript: ENSTTRT00000015772
Sequence length 399
Comment pep:novel genescaffold:turTru1:GeneScaffold_1664:325363:355975:1 gene:ENSTTRG00000015774 transcript:ENSTTRT00000015772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRS
LASYGLKDGDVVILRQKENADPRPSVQFPNLPRIDFRSIAVPGTSNTRQRQPAGAQQSHS
SPGEVASSPQGLDNPALLRDMLLANPHELSLLKERNPPLADALLSGDLEKFSRVLVEQQQ
DRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINC
KVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQ
IEGDFLACSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSKTTFLPEGELPE
CARLAYGAGREEVRPEEIADQELAEALQKSVEDAERQKP
Download sequence
Identical sequences ENSTTRP00000014947 ENSTTRP00000014947 XP_004272477.1.21590 XP_007175029.1.59432 XP_007459347.1.90284 XP_019774469.1.83887 XP_019774470.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]