SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014966 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000014966
Domain Number - Region: 354-406
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0549
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014966   Gene: ENSTTRG00000015793   Transcript: ENSTTRT00000015792
Sequence length 550
Comment pep:novel genescaffold:turTru1:GeneScaffold_1187:445938:510781:1 gene:ENSTTRG00000015793 transcript:ENSTTRT00000015792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANP
PSGIEDETPENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
NIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIXXXXXXXXXVQQGR
TGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASKKANSSVGKWQDQYG
RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFF
PPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRS
ARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYSRREKDRDRDRDRDRERDRDRDRERE
RTRERERERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETR
HKSSRSSNSR
Download sequence
Identical sequences ENSTTRP00000014966 ENSTTRP00000014966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]