SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015112 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015112
Domain Number 1 Region: 256-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 98-160
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000711
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 294-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000308
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015112   Gene: ENSTTRG00000015952   Transcript: ENSTTRT00000015947
Sequence length 432
Comment pep:novel scaffold:turTru1:scaffold_113024:22514:27297:-1 gene:ENSTTRG00000015952 transcript:ENSTTRT00000015947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQFGFVAKMLSEQTAALGTGWESMSVQLDGAEPQVERGSQEEGPWRTAPGPLEHLCCDLE
EEPQSLQEKAQSAPWVPAIPQEGSTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSL
DPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERDILKVTY
TGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEQDESWDSMPRSSRGMLLGPPFLQED
SFSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKSFGRRHH
LIRHQKTHLHDKPSKCSECGKNFRCNSHLASHQRVHAEGKSCKGQEVGESPGARKRQRAP
PVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQS
PRSSWDRGTSVF
Download sequence
Identical sequences ENSTTRP00000015112 ENSTTRP00000015112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]