SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015222 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015222
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000033
Family Ubiquitin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015222   Gene: ENSTTRG00000016067   Transcript: ENSTTRT00000016061
Sequence length 166
Comment pep:novel genescaffold:turTru1:GeneScaffold_3104:212493:212993:1 gene:ENSTTRG00000016067 transcript:ENSTTRT00000016061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLTVQLLLGQRCSLKVSGRQSVAMPKKLVSERLRAPEEQRHLLFRDQLLADDKHLSNYC
IGPNASTNVMVRPLEKTVPEEAHQPQPLWHHLGQVLAKHFGPQDTEAVLQLLRRGHKERL
QRISLGELERLARHLLSEEPLAEPTGEREPEAQRPGDKEGEEEAKQ
Download sequence
Identical sequences ENSTTRP00000015222 ENSTTRP00000015222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]