SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015224 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015224
Domain Number 1 Region: 450-559,681-797
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-53
Family Phosphate binding protein-like 0.00000000989
Further Details:      
 
Domain Number 2 Region: 31-391
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.3e-22
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015224   Gene: ENSTTRG00000016060   Transcript: ENSTTRT00000016063
Sequence length 1464
Comment pep:known genescaffold:turTru1:GeneScaffold_3062:270298:620715:-1 gene:ENSTTRG00000016060 transcript:ENSTTRT00000016063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLGYWTLLVLPALLVWRGPAQGAAAEKGPPALNIAVLLGHSHDVTERELRNLWGPEQA
AGLPLDLNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQT
FIPILGIHGGSSMIMADKDPTSTFFQFGASIQQQVTVMLKIMQDYDWHVFSLVTTIFPGY
RDFISFIKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEERVRDGLGILT
TAASSMLDKFSYIPEAKASCYGQMEKPEVPLHTLHQFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENHTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFIRINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRS
NGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFT
IGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVD
QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSL
KTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTDYGIALQKGSRWKRQIDLAVL
QFVGDGEMEELETLWLTGICHNEKNEVMSSQLDVDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRS
AKNISNLSNVNSSRMDSPKRAADFIQRGSLIMDMVSDKGNLVYSDNRSFQGKESIFGDNM
NELQTFMANRHKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMES
LRQDSLTQNPVSQRDEGTVENRSYSLKSPRYLPEEVAHSDISETSSRATCHREPDNSKNH
KAKDNFKRSVASKYPKDCSEVERSYLKTKASSPRDKIYTIDGEREASFHLDPPQFVENVA
LPENVDFSNVYQDHSDSFRKGDSTLPRNRSPLHDEDGLPNNDQYKLYSKHFTLKDKSSPH
SEGSDRYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDSCLRMGNLYDIDEDQMLQETGNP
ATQEEVYQQDWAQSSALQFQKNKLRISRQHSYDNILDKPRELDLSRPSRSISLKDRERLL
EGNLYGSLFSVPASKLSGNKGSLFPQGLEVSKRSKSLLPDHTSDNPFLHSYGDDQRLVIG
RCPSDPYKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNKMYS
APRVLNSCSNRRVYKKMPSIESDV
Download sequence
Identical sequences ENSTTRP00000015224 ENSTTRP00000015224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]