SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015344 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015344
Domain Number 1 Region: 374-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 433-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.65e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 471-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7e-21
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 339-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 137-195
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000314
Family KRAB domain (Kruppel-associated box) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015344   Gene: ENSTTRG00000016187   Transcript: ENSTTRT00000016187
Sequence length 526
Comment pep:novel genescaffold:turTru1:GeneScaffold_2211:3897:12026:-1 gene:ENSTTRG00000016187 transcript:ENSTTRT00000016187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWIWIKKGRVAALSLSDGLWIVKVEDSPGGGESIYQGTVLDLETSRRHFKAVXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGLVTVQDVAVSLTWEEWERLGPAQRDLYRESAPKDYGNAVSPS
LETRTENKELILKQEILEEVEPQGQLQESQEKGPLSSECGVAHEDRIEKPSXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGNYRHSSLEQRRFHEERYTCDCEKSFKQRSDLFKHQRTH
TGEKPYWCSVCGKSFSQSATLVKHQRTHTGEKPYTCPKCGDSFRQSSNLSRHQRVHMGEK
HYTCHECGEICRISNHFRHQRTHQGERPYTCEECAKSFKRCSDLSKHQRIHTGEKPYECQ
ECGKSFSQSATLVKHQRTHTGEKPYTCPKCGDSFRQSSHLNRHQRV
Download sequence
Identical sequences ENSTTRP00000015344 ENSTTRP00000015344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]