SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015420 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015420
Domain Number 1 Region: 40-243,367-512
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-50
Family FAD-linked reductases, N-terminal domain 0.000000000108
Further Details:      
 
Domain Number 2 Region: 277-367
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.73e-33
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.00000151
Further Details:      
 
Domain Number 3 Region: 514-613
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.54e-28
Family ETF-QO domain-like 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015420   Gene: ENSTTRG00000016267   Transcript: ENSTTRT00000016267
Sequence length 615
Comment pep:novel genescaffold:turTru1:GeneScaffold_2692:237576:272513:1 gene:ENSTTRG00000016267 transcript:ENSTTRT00000016267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVPLARLACPAYQCFHALQIKKNYLPLCATRWSSTSTVPRITTHYTVHPRDKDKRWEGV
NMERFADEADVVIVGAGPAGLSAAARLKQLAAQHEKDIRVCLVEKAAQIGTHTLSGACLD
PRALQELFPDWKEKGAPLNTPVTEDRFGFLTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTFEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWIIDEKKWKPGRVDHTVGWPLDR
HTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLSPFREFQRWKHHPSIQPTLEGGKRVAY
GARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLSSE
NLQSKTIGLDVTEYEDNKKSWVWKELYAIRNVRPSCHGVLGVYGGMIYTGIFYWIFRGME
PWTLKHKGSDSDQLRPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLKDD
SVPVNRNLTIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNIN
WVVPEGGGGPAYNGM
Download sequence
Identical sequences ENSTTRP00000015420 ENSTTRP00000015420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]