SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015459 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015459
Domain Number 1 Region: 660-902
Classification Level Classification E-value
Superfamily vWA-like 8.53e-77
Family Trunk domain of Sec23/24 0.00000566
Further Details:      
 
Domain Number 2 Region: 430-578,903-997
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.49e-75
Family beta-sandwich domain of Sec23/24 0.00048
Further Details:      
 
Domain Number 3 Region: 1104-1252
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 8.89e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 4 Region: 999-1103
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.49e-29
Family Helical domain of Sec23/24 0.0012
Further Details:      
 
Domain Number 5 Region: 577-659
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.83e-23
Family Zn-finger domain of Sec23/24 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015459   Gene: ENSTTRG00000016308   Transcript: ENSTTRT00000016310
Sequence length 1253
Comment pep:novel genescaffold:turTru1:GeneScaffold_1550:100910:192761:1 gene:ENSTTRG00000016308 transcript:ENSTTRT00000016310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPAGSPHPAASSRIPPKLGGAAASGAAAPAGPGPGPHQQNGPAQNQMQVPSGYGLHPQ
SYTAPSGHYSQGPGKMTSLPLDSQCDDYYSGLYRVPTQNVVTPNAASPQPGAQQMYGSVP
PAPHVVGSTLGSFQGAGSSASHLHTSASQPYSSFVNHYNSPAMYSDNSSVAAQGFPSTCG
HYALSTVSNAAYPSVSYPSLPAGDPYGQQMFTSQNAPTVRPIRDNSFSGQNTAISHPSPL
PPPPSQQYHQQQSLSGYNTFAWSASGLPSTQDNLIQNHTSLATANNPTNPVADTLSCSVM
QNVQPPKSSPVVSAVLSGASSTRTPPAASRPVEPLASVARPSELLQQKGMQYGEYVNNQA
SSAPTPLSSTSDDEEEEEEDEEAGVDSSSTTSSASPMPNSYDALEGGSYPDMLSSSASSP
APDPAPAPAPAPAAPQPSKVAKPFGYGYPALQPGYQNAAAPLNSGVPPGSPAYSGFQQYA
QQYPGMNQLSSSLGGLSLQSSSQPESLRPVNLTQERNILPMTPVWAPVPNLNLDLKKLNC
SPDSFRCTLTNIPQTQALLNKAKLPLGLLLHPFRDLTQLPVITSNTIVRCRSCRTYINPF
VSFIDQRRWKCNLCYRVNDVPEEFMYNPLTRSYGEPHKRPEVQNSTVEFIASSDYMLRPP
QPAVYLFVLDVSHNAVEAGYLTILCQSLLENLDKLPGDSRTRIGFMTFDSTIHFYNLQEG
LSQPQMLIVSDIDDVFLPTPDSLLVNLYESKELIKDLLNALPNMFTNTRETHSALGPALQ
AAFKLMSPTGGRVSVFQTQLPSLGAGLLQSREDPNQRSSTKVVQHLGPATDFYKKLALDC
SGQQTAVDLFLLSSQYSDLASLACMSKYSAGCIYYYPSFHYTHNPSQAEKLQKDLKRYLT
RKIGFEAVMRIRCTKGLSMHTFHGNFFVRSTDLLSLANINPDAGFAVQLSIEESLTDTSL
VCFQTALLYTSSKGERRIRVHTLCLPVVSSLADVYAGADVQASICLLANMAVDRSISSSL
SDARDALVNAVVDSLSAYGSTVSNLQHSGLIAPSSLKLFPLYVLALLKQKAFRTGTSTRL
DDRVYAMCQIKCQPLVHLMKMIHPNLYRIDRLTDEGAIHVNDRVVPQPPLQKLSAEKLTR
DGAFLMDCGSVFYIWVGKSCDSNFIEDVLGYPNFASIPQKMTHLPELDTLSSERARSFIT
WLRDNRPLNPILHVVKDESPAKTEFFQHLIEDRTEAAFSYYEFLLHVQQQICK
Download sequence
Identical sequences ENSTTRP00000015459 ENSTTRP00000015459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]